PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G332300.1.p
Common NameLOC101773599, SETIT_010342mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 382aa    MW: 41798.4 Da    PI: 6.1964
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G332300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.78.4e-3196149255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH +F++av++LGG+++AtPk +l+lm+vkgL++ hvkSHLQ+YR+
  Seita.7G332300.1.p  96 PRLRWTPELHLCFLRAVDRLGGQDRATPKLVLQLMNVKGLSIGHVKSHLQMYRS 149
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-2992150IPR009057Homeodomain-like
PROSITE profilePS5129412.91592152IPR017930Myb domain
SuperFamilySSF466891.74E-1593150IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-2395151IPR006447Myb domain, plants
PfamPF002498.3E-997148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MSQGRLSYPS WTSAHPSASS SMMDHQLQSS SAGGDTEEED EEEDAAAAAD MPPGGGRDGS  60
SASNSSTVDE AGGGDSSGRN NPSSSSVRPY VRSKNPRLRW TPELHLCFLR AVDRLGGQDR  120
ATPKLVLQLM NVKGLSIGHV KSHLQMYRSK KIDDSGQVIG GGGSWRDDDH ELQEGGRQAY  180
NLGHLSLHHA QTGAATTLLS ARFGAWPHYW NWLHGHHHHL LGSKPYYSSA ADQADVFLTT  240
TRAHHQYVSR ASILQAGRSS YHQNDQFIRP LLQQRDDEDN HSNHHDPLDL ELALDIGPRR  300
QDNKRIKRSS SGCSLGREED DDKENASRDD DQQVLESATD DTAGLSLSLF SSYPPFARTS  360
VSMDKGEEAH PTRTSTLDLT I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684401e-102BT068440.1 Zea mays full-length cDNA clone ZM_BFb0191O11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703002.10.0PREDICTED: uncharacterized protein LOC101773599
TrEMBLK3Y8010.0K3Y801_SETIT; Uncharacterized protein
STRINGSi010342m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-33G2-like family protein